{"product_id":"proteintech-20409-1-ap","title":"Proteintech, 20409-1-AP, APC15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APC15 (20409-1-AP) by Proteintech is a Polyclonal antibody targeting APC15 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20409-1-AP targets APC15 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HEK-293 cells\nPositive IHC detected in: human placenta tissue, human lung tissue,  human pancreas tissue,  mouse adrenal gland tissue,  mouse lung tissue,  mouse spleen tissue,  rat adrenal gland tissue,  rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14237 Product name: Recombinant human C11orf51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC005156 Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI Predict reactive species\nFull Name: chromosome 11 open reading frame 51\nCalculated Molecular Weight: 121 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC005156\nGene Symbol: APC15\nGene ID (NCBI): 25906\nRRID: AB_10694279\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60006\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884974985385,"sku":"20409-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20409-1-ap","provider":"Iright","version":"1.0","type":"link"}