{"product_id":"proteintech-20427-1-ap","title":"Proteintech, 20427-1-AP, CCDC56\/COA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC56\/COA3 (20427-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC56\/COA3 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20427-1-AP targets CCDC56\/COA3 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman COX assembly factor 3 (COA3), also known as CCDC56 (coiled-coil domain-containing protein 56), is a mitochondrial transmembrane protein responsible for cytochrome c oxidase (COX) protein complex assembly. CCDC56\/COA3 is located on chromosome 17 (17q.21.31) and encodes an 11.7-kDa protein with predicted transmembrane and coiled-coil domains (PMID: 22610097). CCDC56\/COA3 is overexpressed at both mRNA and protein levels in human NSCLC cells, mainly as a result of decreased miR-338-3p level (PMID: 36119836).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14260 Product name: Recombinant human CCDC56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC002698 Sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS Predict reactive species\nFull Name: coiled-coil domain containing 56\nCalculated Molecular Weight: 106 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC002698\nGene Symbol: CCDC56\nGene ID (NCBI): 28958\nRRID: AB_10695182\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2R0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869651652777,"sku":"20427-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20427-1-ap","provider":"Iright","version":"1.0","type":"link"}