{"product_id":"proteintech-20439-1-ap","title":"Proteintech, 20439-1-AP, CLK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLK1 (20439-1-AP) by Proteintech is a Polyclonal antibody targeting CLK1 in WB, IP, ELISA applications with reactivity to human samples\n20439-1-AP targets CLK1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, COLO 320 cells,  HeLa cells,  Jurkat cells,  LNCaP cells\nPositive IP detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLK1 (CDC-like kinase 1) is the dual specificity kinase acting on both serine\/threonine and tyrosine-containing substrates. It phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. It can phosphorylate: SRSF1, SRSF3 and PTPN1 (PMID: 10480872; 19168442). It also regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells (PMID: 19168442). Elevated CLK1 activity is frequently detected in cancers, where it alters splice isoform balance to promote proliferation, invasion and chemoresistance, making it an emerging therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14214 Product name: Recombinant human CLK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC031549 Sequence: MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVED Predict reactive species\nFull Name: CDC-like kinase 1\nCalculated Molecular Weight: 484 aa, 57 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC031549\nGene Symbol: CLK1\nGene ID (NCBI): 1195\nRRID: AB_2878686\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49759\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656961193,"sku":"20439-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20439-1-ap","provider":"Iright","version":"1.0","type":"link"}