{"product_id":"proteintech-20441-1-ap","title":"Proteintech, 20441-1-AP, YIPF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YIPF2 (20441-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF2 in WB, IP, ELISA applications with reactivity to human samples\n20441-1-AP targets YIPF2 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IP detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYIPF2 is a member of YIP family whose name refers to the Ypt (yeast RAB GTPase)-interacting protein predicted to have five transmembrane segments with an N-terminal exposed to the cytoplasm and a short C-terminal exposed to the lumen of the secretory pathway. YIPF2 has been reported to mainly locate in the trans-Golgi network (TGN) co-localized with virous RAB proteins, suggesting that it is potentially involved in vesicle transport (PMID: 31189879). YIPF2 can serve as the GDF (GDI-displacement factor) of RAB5\/RAB22A and intracellular binder of CD147 in HCC cells (PMID: 311898799).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14238 Product name: Recombinant human YIPF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000056 Sequence: MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQQQQQPGFWTFSYYQSF Predict reactive species\nFull Name: Yip1 domain family, member 2\nCalculated Molecular Weight: 316 aa, 35 kDa\nObserved Molecular Weight: 35~40 kDa\nGenBank Accession Number: BC000056\nGene Symbol: YIPF2\nGene ID (NCBI): 78992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925907625,"sku":"20441-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20441-1-ap","provider":"Iright","version":"1.0","type":"link"}