{"product_id":"proteintech-20442-1-ap","title":"Proteintech, 20442-1-AP, EDG2\/LPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDG2\/LPA1 (20442-1-AP) by Proteintech is a Polyclonal antibody targeting EDG2\/LPA1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n20442-1-AP targets EDG2\/LPA1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A375 cells,  HeLa cells,  mouse brain tissue,  multi-cells\/tissue,  A549 cells,  A2780 cells,  NIH3T3 cells\nPositive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14253 Product name: Recombinant human LPAR1,EDG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-364 aa of BC030615 Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV Predict reactive species\nFull Name: lysophosphatidic acid receptor 1\nCalculated Molecular Weight: 364 aa, 41 kDa\nObserved Molecular Weight: 41-50 kDa\nGenBank Accession Number: BC030615\nGene Symbol: EDG2\nGene ID (NCBI): 1902\nRRID: AB_11183048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92633\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868997046441,"sku":"20442-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20442-1-ap","provider":"Iright","version":"1.0","type":"link"}