{"product_id":"proteintech-20446-1-ap","title":"Proteintech, 20446-1-AP, C10orf58 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C10orf58 (20446-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf58 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n20446-1-AP targets C10orf58 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ROS1728 cells\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: ROS1728 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC10orf58, also name as FAM213A and PAMM, is involved in redox regulation of the cell. It acts as an antioxidant. C10orf58 inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. It may affect bone resorption and help to maintain bone mass. The MW of C10orf58 is 24-30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14272 Product name: Recombinant human C10orf58 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-229 aa of BC005871 Sequence: DVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK Predict reactive species\nFull Name: chromosome 10 open reading frame 58\nCalculated Molecular Weight: 229 aa, 26 kDa\nObserved Molecular Weight: 24-30 kDa\nGenBank Accession Number: BC005871\nGene Symbol: C10orf58\nGene ID (NCBI): 84293\nRRID: AB_2878687\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869644738729,"sku":"20446-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20446-1-ap","provider":"Iright","version":"1.0","type":"link"}