{"product_id":"proteintech-20478-1-ap","title":"Proteintech, 20478-1-AP, WDR40A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR40A (20478-1-AP) by Proteintech is a Polyclonal antibody targeting WDR40A in WB, IHC, ELISA applications with reactivity to human samples\n20478-1-AP targets WDR40A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  Jurkat cells\nPositive IHC detected in: human lung cancer tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR40A, also known as DCAF12, is a 51 kDa protein. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex(PMID: 16949367). This antibody specifically recognises the 51 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14349 Product name: Recombinant human WDR40A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC008893 Sequence: LHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFHLGT Predict reactive species\nFull Name: WD repeat domain 40A\nCalculated Molecular Weight: 453 aa, 51 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC008893\nGene Symbol: WDR40A\nGene ID (NCBI): 25853\nRRID: AB_2878692\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T6F0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887922598057,"sku":"20478-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20478-1-ap","provider":"Iright","version":"1.0","type":"link"}