{"product_id":"proteintech-20483-1-ap","title":"Proteintech, 20483-1-AP, WDR32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR32 (20483-1-AP) by Proteintech is a Polyclonal antibody targeting WDR32 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20483-1-AP targets WDR32 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human testis tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR32, containing seven WD repeats, is also termed DDB1- and CUL4-associated factor 10 (DCAF10), which may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex (PMID: 16949367). WDR32 is able to interact with DDB1 (PMID: 16949367). WDR32 is supposed to be implicated in process of ubiquitin-dependent protein degradation system. Two isoforms are described and produced by alternative splicing. Proteintech's WDR32 antibody 20483-1-AP majorly detects WDR32 isoform1 with a theoretical MW of 61 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14360 Product name: Recombinant human WDR32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC003520 Sequence: TRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTNSLEVGSYPILRARRTTSSSGVSPRNSLEVVTPEVLGESDHGNCITSLQLHPKGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLRLTHYIEEANVGRGYIKELCFSPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF Predict reactive species\nFull Name: WD repeat domain 32\nCalculated Molecular Weight: 559 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC003520\nGene Symbol: WDR32\nGene ID (NCBI): 79269\nRRID: AB_10695183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5QP82\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887922237609,"sku":"20483-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20483-1-ap","provider":"Iright","version":"1.0","type":"link"}