{"product_id":"proteintech-20520-1-ap","title":"Proteintech, 20520-1-AP, FAM164C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM164C (20520-1-AP) by Proteintech is a Polyclonal antibody targeting FAM164C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n20520-1-AP targets FAM164C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  C6 cells\nPositive IHC detected in: human kidney tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM164C, also named as ZC2HC1C or C14orf140, is a 456 amino acid protein, which contains one C2HC-type zinc finger and belongs to the ZC2HC1 family. FAM164C exists as two isoforms. The isoform1 is a 51kDa protein ad isoform2 is 31kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14359 Product name: Recombinant human FAM164C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC004259 Sequence: MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG Predict reactive species\nFull Name: family with sequence similarity 164, member C\nCalculated Molecular Weight: 275 aa, 31 kDa\nObserved Molecular Weight: 31-36 kDa\nGenBank Accession Number: BC004259\nGene Symbol: FAM164C\nGene ID (NCBI): 79696\nRRID: AB_2878697\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53FD0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887631618217,"sku":"20520-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20520-1-ap","provider":"Iright","version":"1.0","type":"link"}