{"product_id":"proteintech-20521-1-ap","title":"Proteintech, 20521-1-AP, IL-20RB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-20RB (20521-1-AP) by Proteintech is a Polyclonal antibody targeting IL-20RB in WB, ELISA applications with reactivity to human samples\n20521-1-AP targets IL-20RB in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1\/IL20RB dimer is a receptor for IL20 and IL24.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14368 Product name: Recombinant human IL-20RB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC033292 Sequence: MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC Predict reactive species\nFull Name: interleukin 20 receptor beta\nCalculated Molecular Weight: 311 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC033292\nGene Symbol: IL-20RB\nGene ID (NCBI): 53833\nRRID: AB_10700002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXL0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869551153321,"sku":"20521-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20521-1-ap","provider":"Iright","version":"1.0","type":"link"}