{"product_id":"proteintech-20627-1-ap","title":"Proteintech, 20627-1-AP, SOX8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX8 (20627-1-AP) by Proteintech is a Polyclonal antibody targeting SOX8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20627-1-AP targets SOX8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, COLO 320 cells,  HeLa cells,  rat brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14556 Product name: Recombinant human SOX8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 298-446 aa of BC031797 Sequence: EPGQAYGGAYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGSCSGQSSATPAAPAGPFAGSQGDYGDLQASSYYGAYPGYAPGLYQYPCFHSPRRPYASPLLNGLALPPAHSPTSHWDQPVYTTLTRP Predict reactive species\nFull Name: SRY (sex determining region Y)-box 8\nCalculated Molecular Weight: 446 aa, 47 kDa\nObserved Molecular Weight: 47-55 kDa\nGenBank Accession Number: BC031797\nGene Symbol: SOX8\nGene ID (NCBI): 30812\nRRID: AB_10693538\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57073\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385576617,"sku":"20627-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20627-1-ap","provider":"Iright","version":"1.0","type":"link"}