{"product_id":"proteintech-20635-1-ap","title":"Proteintech, 20635-1-AP, PPAPDC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPAPDC3 (20635-1-AP) by Proteintech is a Polyclonal antibody targeting PPAPDC3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n20635-1-AP targets PPAPDC3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14676 Product name: Recombinant human PPAPDC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC006362 Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL Predict reactive species\nFull Name: phosphatidic acid phosphatase type 2 domain containing 3\nCalculated Molecular Weight: 271 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC006362\nGene Symbol: PPAPDC3\nGene ID (NCBI): 84814\nRRID: AB_10696180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NBV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869488992425,"sku":"20635-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20635-1-ap","provider":"Iright","version":"1.0","type":"link"}