{"product_id":"proteintech-20751-1-ap","title":"Proteintech, 20751-1-AP, NPT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPT1 (20751-1-AP) by Proteintech is a Polyclonal antibody targeting NPT1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20751-1-AP targets NPT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human placenta tissue,  mouse kidney tissue,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPT1 (also known as SLC17A1) is a member of sodium-dependent inorganic phosphate transporters (NPT), which regulates entrance into the cellular membrane. NPT1 is mainly expressed in the kidney transporting small organic anions such as PAH (para-aminohippurate), but it is also found in the liver and brain. NTP1 localizes to the apical membrane of renal proximal tubular cells. NPT1 exits two isoforms due to the alternative splicing. Western blot analysis using this antibody detected a major band around 45-55 kDa in kidney tissue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12819 Product name: Recombinant human NPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC101745 Sequence: MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYST Predict reactive species\nFull Name: solute carrier family 17 (sodium phosphate), member 1\nCalculated Molecular Weight: 467 aa, 51 kDa\nObserved Molecular Weight: 50 kDa, 60-64 kDa\nGenBank Accession Number: BC101745\nGene Symbol: NPT1\nGene ID (NCBI): 6568\nRRID: AB_10693677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14916\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005893801,"sku":"20751-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20751-1-ap","provider":"Iright","version":"1.0","type":"link"}