{"product_id":"proteintech-20753-1-ap","title":"Proteintech, 20753-1-AP, ALG6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALG6 (20753-1-AP) by Proteintech is a Polyclonal antibody targeting ALG6 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20753-1-AP targets ALG6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALG6 gene encodes an α-1,3-glucosyltransferase used to add the first glucose to the immature lipid-linked oligosaccharide (LLO) precursor. ALG6 has 14 transmembrane helices and two long loops (EL1 and EL4) that forms a large, hydrophilic cavity facing the ER lumen and a groove-shaped cavity facing the lipid bilayer (PMID: 21334936).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14176 Product name: Recombinant human ALG6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-125 aa of BC001253 Sequence: GLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYI Predict reactive species\nFull Name: asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae)\nCalculated Molecular Weight: 507 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC001253\nGene Symbol: ALG6\nGene ID (NCBI): 29929\nRRID: AB_10693678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y672\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869807104169,"sku":"20753-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20753-1-ap","provider":"Iright","version":"1.0","type":"link"}