{"product_id":"proteintech-20778-1-ap","title":"Proteintech, 20778-1-AP, WDR24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR24 (20778-1-AP) by Proteintech is a Polyclonal antibody targeting WDR24 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n20778-1-AP targets WDR24 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR24 is a component of the GATOR2 complex which has five known subunits (WDR24, WDR59, Mios, Sec13, and Seh1L). GATOR2 complex positively regulates mTORC1 signaling by acting upstream of or in parallel to GATOR1, which is a GTPase-activating protein (GAP) for RagA or RagB and an inhibitor of the amino-acid-sensing pathway. (PMID: 23723238; 25263562)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14774 Product name: Recombinant human WDR24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 440-790 aa of BC008025 Sequence: LGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS Predict reactive species\nFull Name: WD repeat domain 24\nCalculated Molecular Weight: 920 aa, 102 kDa\nObserved Molecular Weight: 102 kDa, 88 kDa\nGenBank Accession Number: BC008025\nGene Symbol: WDR24\nGene ID (NCBI): 84219\nRRID: AB_10696183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868865286313,"sku":"20778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20778-1-ap","provider":"Iright","version":"1.0","type":"link"}