{"product_id":"proteintech-20780-1-ap","title":"Proteintech, 20780-1-AP, C11orf70 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C11orf70 (20780-1-AP) by Proteintech is a Polyclonal antibody targeting C11orf70 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20780-1-AP targets C11orf70 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  MCF-7 cells\nPositive IHC detected in: human testis tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CFAP300 protein is an important member of the cilia- and flagella-associated protein family, localized in the basal body and axoneme structures of cellular cilia. It plays a central role in ciliary assembly and stability, primarily by participating in the transport and anchoring of pre-assembled complexes within the cytoplasm. Research indicates that mutations in the CFAP300 gene lead to structural and functional defects in cilia, which are closely associated with various human ciliopathies, such as primary ciliary dyskinesia, heterotaxy, and male infertility. Loss of its function disrupts intraflagellar transport, affecting key physiological processes including left-right axis determination during embryonic development and mucociliary clearance in the respiratory tract. Therefore, CFAP300 is a crucial protein molecule for understanding ciliary biology and the mechanisms of related diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14793 Product name: Recombinant human C11orf70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC006128 Sequence: MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS Predict reactive species\nFull Name: chromosome 11 open reading frame 70\nCalculated Molecular Weight: 267 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC006128\nGene Symbol: C11orf70\nGene ID (NCBI): 85016\nRRID: AB_10755147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRQ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885377999017,"sku":"20780-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20780-1-ap","provider":"Iright","version":"1.0","type":"link"}