{"product_id":"proteintech-20786-1-ap","title":"Proteintech, 20786-1-AP, WDR55 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR55 (20786-1-AP) by Proteintech is a Polyclonal antibody targeting WDR55 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n20786-1-AP targets WDR55 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWD repeat domain 55 (WDR55) also named as, FLJ20195, is a 383 amino acid protein, which contains seven WD repeats and belongs to the WD repeat WDR55 family. WDR55 localizes in the nucleus and cytoplasm. WDR55 acts as a modulator of rRNA synthesis and play a central role in organogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14241 Product name: Recombinant human WDR55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-383 aa of BC002482 Sequence: MDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSSKTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD Predict reactive species\nFull Name: WD repeat domain 55\nCalculated Molecular Weight: 383 aa, 42 kDa\nObserved Molecular Weight: 42-50 kDa\nGenBank Accession Number: BC002482\nGene Symbol: WDR55\nGene ID (NCBI): 54853\nRRID: AB_2878739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6Y2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887922761897,"sku":"20786-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20786-1-ap","provider":"Iright","version":"1.0","type":"link"}