{"product_id":"proteintech-20795-1-ap","title":"Proteintech, 20795-1-AP, HMGA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGA2 (20795-1-AP) by Proteintech is a Polyclonal antibody targeting HMGA2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human,   mouse, rat samples\n20795-1-AP targets HMGA2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human,   mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  NIH\/3T3 cells,  C6 cells,  HCT 116 cells,  NCI-H1299 cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: human pancreas cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMGA2 belongs to the family of high mobility group with AT-hook DNA binding domain. HMGA proteins are considered architectural transcription factors; they do not have direct transcriptional activation capacity, but instead regulate gene expression by changing DNA conformation through binding to AT-rich regions in the DNA and\/or direct interaction with other transcription factors (PMID: 18202751,19551524). HMGA2 is abundantly and ubiquitously expressed and plays a crucial role during embryonic development (18425117). HMGA2 promotes stem cell self-renewal and research studies have shown that decreased HMGA2 expression is associated with stem cell aging (19551524). Investigators have shown that expression levels of HMGA2 are very low in normal adult tissues, while either overexpression or rearrangement is associated with many types of cancer (PMID: 20228781). The calcualted molecular weight of HMGA2 is 12 kDa, but modified HMGA2 is about 18-20 kDa. (PMID: 18505920 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14588 Product name: Recombinant human HMGA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of NM_003483 Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED Predict reactive species\nFull Name: high mobility group AT-hook 2\nCalculated Molecular Weight: 108 aa, 12 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: NM_003483\nGene Symbol: HMGA2\nGene ID (NCBI): 8091\nRRID: AB_2665377\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52926\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848509097,"sku":"20795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20795-1-ap","provider":"Iright","version":"1.0","type":"link"}