{"product_id":"proteintech-20803-1-ap","title":"Proteintech, 20803-1-AP, CLASP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLASP1 (20803-1-AP) by Proteintech is a Polyclonal antibody targeting CLASP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20803-1-AP targets CLASP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  rat brain tissue,  SH-SY5Y cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLASP1 is a member of CLASP family. Members of the CLASP family of proteins are involved in multiple MT-dependent processes, including Golgi complex organization and trafficking, kinetochore fiber dynamics and flux, mitotic spindle assembly, and the stabilization of MT plus ends near the cortex. CLASP proteins regulate MT dynamics by promoting MT rescue and suppressing MT catastrophe. Recent work showed that CLASP1 activity is required for proper positioning of the mitotic spindle in both the C. elegans embryo and mammalian cells. Recent work has also identified roles CLASP1 in the regulation of spindle positioning.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14724 Product name: Recombinant human CLASP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC112940 Sequence: MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVNSSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMDQAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSAND Predict reactive species\nFull Name: cytoplasmic linker associated protein 1\nCalculated Molecular Weight: 1538 aa, 169 kDa\nObserved Molecular Weight: 162 kDa\nGenBank Accession Number: BC112940\nGene Symbol: CLASP1\nGene ID (NCBI): 23332\nRRID: AB_10697808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z460\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656240297,"sku":"20803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20803-1-ap","provider":"Iright","version":"1.0","type":"link"}