{"product_id":"proteintech-20808-1-ap","title":"Proteintech, 20808-1-AP, C16orf14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C16orf14 (20808-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf14 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20808-1-AP targets C16orf14 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse skin tissue,  K-562 cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14754 Product name: Recombinant human C16orf14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC007346 Sequence: MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSLAAGATAAGWWPSR Predict reactive species\nFull Name: chromosome 16 open reading frame 14\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 8 kDa, 18 kDa\nGenBank Accession Number: BC007346\nGene Symbol: C16orf14\nGene ID (NCBI): 84331\nRRID: AB_10700013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869519466665,"sku":"20808-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20808-1-ap","provider":"Iright","version":"1.0","type":"link"}