{"product_id":"proteintech-20812-1-ap","title":"Proteintech, 20812-1-AP, APBA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APBA3 (20812-1-AP) by Proteintech is a Polyclonal antibody targeting APBA3 in WB, ELISA applications with reactivity to human samples\n20812-1-AP targets APBA3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HT-1080 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe APBA (MINT) family is a family of adaptor proteins composed of APBA1 (MINT1), APBA2 (MINT2), and APBA3 (MINT3). These proteins are involved in neuronal protein transport and synaptic function. APBA3 plays an essential role in mediating the transport of APP from the TGN to the plasma membrane (PMID: 24410826).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14771 Product name: Recombinant human APBA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-412 aa of BC008338 Sequence: IAQAIGQAFAAAYSQFLRESGIDPSQVGVHPSPGARHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVES Predict reactive species\nFull Name: amyloid beta (A4) precursor protein-binding, family A, member 3\nCalculated Molecular Weight: 575 aa, 61 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC008338\nGene Symbol: APBA3\nGene ID (NCBI): 9546\nRRID: AB_3669349\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O96018\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971610281,"sku":"20812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20812-1-ap","provider":"Iright","version":"1.0","type":"link"}