{"product_id":"proteintech-20820-1-ap","title":"Proteintech, 20820-1-AP, PTDSS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTDSS1 (20820-1-AP) by Proteintech is a Polyclonal antibody targeting PTDSS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n20820-1-AP targets PTDSS1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, unboiled HEK-293 cells,  HeLa cells,  unboiled HeLa cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTDSS1 gene encodes the enzyme phosphatidylserine synthase 1 (PSS1), which catalyzes the production of phosphatidylserine (PS), a membrane phospholipid involved in different cellular processes such as development, cell signaling, apoptosis, and blood coagulation (PMID: 35224839). PTDSS1 is highly enriched in mitochondria-associated membranes (MAM) and is largely excluded from the bulk of the endoplasmic reticulum (ER). Low apparent molecular mass of 40 kDa compared with the size predicted was attributed to the exceptionally high content of hydrophobic amino acids in PSS1 (PMID: 10938271).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14170 Product name: Recombinant human PTDSS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-473 aa of BC002376 Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK Predict reactive species\nFull Name: phosphatidylserine synthase 1\nCalculated Molecular Weight: 473 aa, 56 kDa\nObserved Molecular Weight: 38~40 kDa\nGenBank Accession Number: BC002376\nGene Symbol: PTDSS1\nGene ID (NCBI): 9791\nRRID: AB_3669350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776616617,"sku":"20820-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20820-1-ap","provider":"Iright","version":"1.0","type":"link"}