{"product_id":"proteintech-20851-1-ap","title":"Proteintech, 20851-1-AP, GRINA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRINA (20851-1-AP) by Proteintech is a Polyclonal antibody targeting GRINA in WB, IHC, ELISA applications with reactivity to human samples\n20851-1-AP targets GRINA in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlutamate Receptor Ionotropic NMDA-Associated Protein 1 (GRINA, also known as TMBIM3) is a transmembrane protein involved in calcium homeostasis and cell survival. It plays a crucial role in regulating intracellular calcium levels, which are essential for processes such as cell survival, neurotransmitter release, and apoptosis (PMID: 32124700). GRINA also involves vesicle transport and sorting, particularly in secretory cells like neurons and mammary glands (PMID: 31426446). Additionally, GRINA has been implicated in regulating aerobic glycolysis and tumor progression in gastric cancer (PMID: 30541591).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14716 Product name: Recombinant human GRINA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC041788 Sequence: MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQNPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLT Predict reactive species\nFull Name: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)\nCalculated Molecular Weight: 371 aa, 41 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC041788\nGene Symbol: GRINA\nGene ID (NCBI): 2907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z429\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887659765929,"sku":"20851-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20851-1-ap","provider":"Iright","version":"1.0","type":"link"}