{"product_id":"proteintech-20853-1-ap","title":"Proteintech, 20853-1-AP, THAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THAP2 (20853-1-AP) by Proteintech is a Polyclonal antibody targeting THAP2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20853-1-AP targets THAP2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse testis tissue\nPositive IF\/ICC detected in: Hela cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHAP2, also named as THAP domain-containing protein 2, is a 228 amino acid protein, which contains one THAP-type zinc finger. Members of the THAP (thanatos-associated protein) family of proteins contain a well conserved DNA-binding domain known as the THAP-type zinc finger motif. Proteins containing the THAP-type zinc finger motif are commonly involved in transcriptional regulation, cell-cycle control, apoptosis and chromatin modification\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14775 Product name: Recombinant human THAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-228 aa of BC008358 Sequence: CTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI Predict reactive species\nFull Name: THAP domain containing, apoptosis associated protein 2\nCalculated Molecular Weight: 228 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC008358\nGene Symbol: THAP2\nGene ID (NCBI): 83591\nRRID: AB_10732806\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0W7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869503836329,"sku":"20853-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20853-1-ap","provider":"Iright","version":"1.0","type":"link"}