{"product_id":"proteintech-20857-1-ap","title":"Proteintech, 20857-1-AP, SLC38A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A4 (20857-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n20857-1-AP targets SLC38A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  L02 cells\nPositive IHC detected in: human kidney tissue, human liver cancer tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14827 Product name: Recombinant human SLC38A4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-77 aa of BC101827 Sequence: MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEHHPGTTSF Predict reactive species\nFull Name: solute carrier family 38, member 4\nCalculated Molecular Weight: 547 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC101827\nGene Symbol: SLC38A4\nGene ID (NCBI): 55089\nRRID: AB_10696186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969I6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869500133545,"sku":"20857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20857-1-ap","provider":"Iright","version":"1.0","type":"link"}