{"product_id":"proteintech-20858-1-ap","title":"Proteintech, 20858-1-AP, TCERG1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCERG1L (20858-1-AP) by Proteintech is a Polyclonal antibody targeting TCERG1L in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n20858-1-AP targets TCERG1L in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCERG1L, Transcription elongation regulator 1-like protein, is associated with plasma adiponectin, and plasma adiponectin is a key modulator of obesity, inflammation, IR and diabetes (PMID:22791750). Gene silencing of FBN2 and TCERG1L is associated with promoter DNA hypermethylation in CRC tumors and may be biomarkers for the early detection of CRC (PMID:22238052). Stra8 and TCERG1L play a role in retinoic acid induced spermatogonial differentiation in mouse (PMID:3395975).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14828 Product name: Recombinant human TCERG1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 337-545 aa of BC042951 Sequence: DLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNRTEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEKSKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNKFILILKKRDKENRLRLRKMR Predict reactive species\nFull Name: transcription elongation regulator 1-like\nCalculated Molecular Weight: 586 aa, 66 kDa\nGenBank Accession Number: BC042951\nGene Symbol: TCERG1L\nGene ID (NCBI): 256536\nRRID: AB_3085624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VWI1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887824785577,"sku":"20858-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20858-1-ap","provider":"Iright","version":"1.0","type":"link"}