{"product_id":"proteintech-20866-1-ap","title":"Proteintech, 20866-1-AP, SLC15A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC15A3 (20866-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20866-1-AP targets SLC15A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 15 member 3 (SLC15A3) is a proton-coupled amino-acid transporter, which transports free histidine and certain di- and tripeptides, and is involved in the innate immune response. It can transport carnosine as well (PMID:31073693). SLC15A3 has a calculated molecular weight of 64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14915 Product name: Recombinant human SLC15A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-379 aa of BC037974 Sequence: MGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNFFPANPANISVALRAQGSSYTIPEAWLLLAN Predict reactive species\nFull Name: solute carrier family 15, member 3\nCalculated Molecular Weight: 581 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC037974\nGene Symbol: SLC15A3\nGene ID (NCBI): 51296\nRRID: AB_2935450\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IY34\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869764735145,"sku":"20866-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20866-1-ap","provider":"Iright","version":"1.0","type":"link"}