{"product_id":"proteintech-20868-1-ap","title":"Proteintech, 20868-1-AP, CALCR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CALCR (20868-1-AP) by Proteintech is a Polyclonal antibody targeting CALCR in WB, ELISA applications with reactivity to human, mouse samples\n20868-1-AP targets CALCR in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, PC-12 cells,  mouse brain tissue,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CALCR protein, also known as the calcitonin receptor, is a high-affinity receptor for the peptide hormone calcitonin and belongs to the subfamily of seven transmembrane-spanning G protein-coupled receptors. This protein plays a critical role in maintaining calcium homeostasis and regulating osteoclast-mediated bone resorption. The calcitonin receptor is involved in several physiological processes, including inhibition of osteoclastic bone resorption and increased renal calcium excretion, which helps to regulate Ca2+ concentrations. In addition, the CALCR protein has been detected in a variety of tissues not directly involved in the regulation of calcium homeostasis, with particular expression observed in the brain, suggesting distinct functions in the central nervous system (CNS) (PMID: 12730726).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14920 Product name: Recombinant human CALCR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-164 aa of BC075028 Sequence: AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLV Predict reactive species\nFull Name: calcitonin receptor\nCalculated Molecular Weight: 490 aa, 57 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC075028\nGene Symbol: CALCR\nGene ID (NCBI): 799\nRRID: AB_2878754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30988\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977746089,"sku":"20868-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20868-1-ap","provider":"Iright","version":"1.0","type":"link"}