{"product_id":"proteintech-20881-1-ap","title":"Proteintech, 20881-1-AP, Synaptotagmin-10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptotagmin-10 (20881-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-10 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20881-1-AP targets Synaptotagmin-10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT10 (synaptotagmin-10)  functions as a Ca2+ sensor to trigger IGF-1 exocytosis in neurons. Loss of Syt10 impairs activity-dependent IGF-1 secretion in olfactory bulb neurons and results in smaller neurons and an overall reduction in the number of synapses (PMID: 21496647).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15018 Product name: Recombinant human SYT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC101024 Sequence: MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS Predict reactive species\nFull Name: synaptotagmin X\nCalculated Molecular Weight: 523 aa, 59 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC101024\nGene Symbol: Synaptotagmin-10\nGene ID (NCBI): 341359\nRRID: AB_3669351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6XYQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820394665,"sku":"20881-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20881-1-ap","provider":"Iright","version":"1.0","type":"link"}