{"product_id":"proteintech-20892-1-ap","title":"Proteintech, 20892-1-AP, SEC23IP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC23IP (20892-1-AP) by Proteintech is a Polyclonal antibody targeting SEC23IP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20892-1-AP targets SEC23IP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  HeLa cells,  U-251 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC23-interacting protein (SEC23IP), also known as p125, is a member of the phosphatidic acid preferring-phospholipase A1 family. SEC23IP interacts with Sec23, a coat component of COPII vesicles which are involved in protein export from the endoplasmic reticulum (ER). SEC23IP localizes to ER exit sites and participates in the organization of this compartment (PMID: 15623529). It may have a role in the early stage of the secretory pathway (PMID: 10400679).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14916 Product name: Recombinant human SEC23IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-1000 aa of BC063800 Sequence: ETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH Predict reactive species\nFull Name: SEC23 interacting protein\nCalculated Molecular Weight: 1000 aa, 111 kDa\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: BC063800\nGene Symbol: SEC23IP\nGene ID (NCBI): 11196\nRRID: AB_10896458\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6Y8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869497315497,"sku":"20892-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20892-1-ap","provider":"Iright","version":"1.0","type":"link"}