{"product_id":"proteintech-20916-1-ap","title":"Proteintech, 20916-1-AP, WDR37 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR37 (20916-1-AP) by Proteintech is a Polyclonal antibody targeting WDR37 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20916-1-AP targets WDR37 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe function of WDR37 remains largely unknown. Catalog#20916-1-AP is a rabbit polyclonal antibody raised against the full-length of human WDR37. The MW of this protein is 55 kDa, and this antibody specially recognises the 55 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15112 Product name: Recombinant human WDR37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC018044 Sequence: MPTESASCSTTRQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDKTAHIWRYAVQLPTPQPVADTSVS Predict reactive species\nFull Name: WD repeat domain 37\nCalculated Molecular Weight: 494 aa, 55 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC018044\nGene Symbol: WDR37\nGene ID (NCBI): 22884\nRRID: AB_10695501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2I8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627568297,"sku":"20916-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20916-1-ap","provider":"Iright","version":"1.0","type":"link"}