{"product_id":"proteintech-20952-1-ap","title":"Proteintech, 20952-1-AP, ABHD14B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABHD14B (20952-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD14B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20952-1-AP targets ABHD14B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  mouse small intestine tissue\nPositive IHC detected in: human prostate hyperplasia tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABHD14B possessed the canonical ABHD fold, an invariant catalytic triad (Ser-His-Asp), and based on its protein sequence, was subsequently categorized as an outlying member of the metabolic serine hydrolase family. ABHD14B was able to transfer an acetyl group from post translationally modified protein lysine residue to coenzyme-A (CoA), thus making the biologically important acetyl-CoA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15097 Product name: Recombinant human ABHD14B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC007234 Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ Predict reactive species\nFull Name: abhydrolase domain containing 14B\nCalculated Molecular Weight: 210 aa, 22 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC007234\nGene Symbol: ABHD14B\nGene ID (NCBI): 84836\nRRID: AB_10733758\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96IU4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869798617257,"sku":"20952-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20952-1-ap","provider":"Iright","version":"1.0","type":"link"}