{"product_id":"proteintech-21030-1-ap","title":"Proteintech, 21030-1-AP, ARRDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARRDC1 (21030-1-AP) by Proteintech is a Polyclonal antibody targeting ARRDC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n21030-1-AP targets ARRDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HEK-293 exosomes,  human plasma,  human plasma exosomes\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARRDC1, or Arrestin-Domain Containing Protein 1, is a protein that plays a significant role in the formation and release of extracellular vesicles, specifically a subtype known as ARMMs (Arrestin-Domain Containing Protein 1-mediated microvesicles). ARRDC1 is localized to the cytosolic side of the plasma membrane and recruits the ESCRT-I complex protein TSG101 to initiate outward membrane budding. This protein is also involved in the regulation of protein cargo and release of extracellular vesicles, including both exosomes and ectosomes. The absence of ARRDC1 can lead to changes in the protein cargo within these vesicles, indicating its importance in the sorting and packaging process.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15341 Product name: Recombinant human ARRDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-433 aa of BC032346 Sequence: HSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQSCGGVEPSLTPES Predict reactive species\nFull Name: arrestin domain containing 1\nCalculated Molecular Weight: 433 aa, 46 kDa\nObserved Molecular Weight: 46-50 kDa\nGenBank Accession Number: BC032346\nGene Symbol: ARRDC1\nGene ID (NCBI): 92714\nRRID: AB_3085633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5I2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885071749289,"sku":"21030-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21030-1-ap","provider":"Iright","version":"1.0","type":"link"}