{"product_id":"proteintech-21045-1-ap","title":"Proteintech, 21045-1-AP, ESRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESRP1 (21045-1-AP) by Proteintech is a Polyclonal antibody targeting ESRP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n21045-1-AP targets ESRP1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, mouse lung tissue,  MCF-7 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human lung tissue, mouse colon tissue,  human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESRP1, also named as Epithelial splicing regulatory protein 1, is a 681 amino acid protein, which belongs to the ESRP family. ESRP1 as a mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. ESRP1 specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2 and also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). ESRP1 exists various isoforms and molecular weight of each isoform is 76 kDa, 67 kDa, and 73 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15386 Product name: Recombinant human ESRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-226 aa of BC099916 Sequence: EKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTV Predict reactive species\nFull Name: epithelial splicing regulatory protein 1\nCalculated Molecular Weight: 681 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC099916\nGene Symbol: ESRP1\nGene ID (NCBI): 54845\nRRID: AB_2878801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NXG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940816553,"sku":"21045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21045-1-ap","provider":"Iright","version":"1.0","type":"link"}