{"product_id":"proteintech-21050-1-ap","title":"Proteintech, 21050-1-AP, EPCAM\/CD326 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPCAM\/CD326 (21050-1-AP) by Proteintech is a Polyclonal antibody targeting EPCAM\/CD326 in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC, ELISA applications with reactivity to human, mouse, rat samples\n21050-1-AP targets EPCAM\/CD326 in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse colon tissue,  rat colon tissue\nPositive IHC detected in: human colon cancer tissue, mouse colon tissue,  human breast cancer tissue,  human colon tissue,  mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse colon tissue, MCF-7 cells,  mouse lung tissue\nPositive IF-Fro detected in: mouse colon tissue\nPositive IF\/ICC detected in: HT-29 cells, MCF-7 cells\nPositive FC detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC): FC : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEpithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15393 Product name: Recombinant human EPCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-264 aa of BC014785 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL Predict reactive species\nFull Name: epithelial cell adhesion molecule\nCalculated Molecular Weight: 314 aa, 35 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC014785\nGene Symbol: EPCAM\nGene ID (NCBI): 4072\nRRID: AB_10693684\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16422\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868830322857,"sku":"21050-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21050-1-ap","provider":"Iright","version":"1.0","type":"link"}