{"product_id":"proteintech-21056-1-ap","title":"Proteintech, 21056-1-AP, VSIG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VSIG2 (21056-1-AP) by Proteintech is a Polyclonal antibody targeting VSIG2 in IHC, ELISA applications with reactivity to human, mouse samples\n21056-1-AP targets VSIG2 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVSIG2, also known as CTXL (cortical thymocyte-like protein), belongs to the V-Set and immunoglobulin (Ig) domain-containing (VSIG) family. The VSIG family is also a member of the immunoglobulin superfamily (IgSF). VSIG2 has been recognized as a novel immune checkpoint that plays a role in regulating immune response. VSIG2 was associated with the development and progression of colon adenocarcinoma (COAD)  and pancreatic ductal adenocarcinoma (PDAC) and could be used as a potential biomarker(PMID: 34290531;PMID: 37626304).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14342 Product name: Recombinant human VSIG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-243 aa of BC007313 Sequence: VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA Predict reactive species\nFull Name: V-set and immunoglobulin domain containing 2\nCalculated Molecular Weight: 327 aa, 34 kDa\nGenBank Accession Number: BC007313\nGene Symbol: VSIG2\nGene ID (NCBI): 23584\nRRID: AB_3669354\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96IQ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887920828585,"sku":"21056-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21056-1-ap","provider":"Iright","version":"1.0","type":"link"}