{"product_id":"proteintech-21058-1-ap","title":"Proteintech, 21058-1-AP, LHFPL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LHFPL5 (21058-1-AP) by Proteintech is a Polyclonal antibody targeting LHFPL5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21058-1-AP targets LHFPL5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse epididymis tissue, rat epididymis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLHFPL5 (lipoma HMGIC fusion partner-like 5), previously known as TMHS (tetraspan membrane protein of hair cell stereocilia), is necessary for proper MET channel function. LHFPL5 is a four transmembrane segment protein from the superfamily of tetraspan proteins that includes the claudin tight junction proteins, gap junction proteins, peripheral myelin proteins, and ion channel auxiliary subunits (PMID: 36781873).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14663 Product name: Recombinant human LHFPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-124 aa of BC028630 Sequence: SYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTA Predict reactive species\nFull Name: lipoma HMGIC fusion partner-like 5\nCalculated Molecular Weight: 219 aa, 24 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC028630\nGene Symbol: LHFPL5\nGene ID (NCBI): 222662\nRRID: AB_3669355\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887703412905,"sku":"21058-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21058-1-ap","provider":"Iright","version":"1.0","type":"link"}