{"product_id":"proteintech-21068-1-ap","title":"Proteintech, 21068-1-AP, MAZ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAZ (21068-1-AP) by Proteintech is a Polyclonal antibody targeting MAZ in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21068-1-AP targets MAZ in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse lung tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyc-associated zinc finger protein (MAZ) is a six zinc finger protein with a G-rich binding motif. MAZ is often found at genomic binding sites adjacent to CTCF, a protein which affects large-scale genome organization through its interaction with cohesin (PMID: 33558242). MAZ is widely expressed in most human tissues, such as heart, lung, brain, liver, placenta, testis, colon, peripheral blood leukocytes, skeletal muscle, thymus, pancreas, prostate, thyroid, and adrenal gland (PMID: 35098656). In cancer, MAZ has been proved to be highly expressed in malignant tumors, and to promote cancer progression and metastasis by regulating the transcription of downstream target genes through directly binding with target gene promoters or synergistic action with other transcription factors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15200 Product name: Recombinant human MAZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC041629 Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG Predict reactive species\nFull Name: MYC-associated zinc finger protein (purine-binding transcription factor)\nCalculated Molecular Weight: 477 aa, 49 kDa\nObserved Molecular Weight: 49-55 kDa\nGenBank Accession Number: BC041629\nGene Symbol: MAZ\nGene ID (NCBI): 4150\nRRID: AB_2878805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56270\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969980073,"sku":"21068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21068-1-ap","provider":"Iright","version":"1.0","type":"link"}