{"product_id":"proteintech-21070-1-ap","title":"Proteintech, 21070-1-AP, ELOF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELOF1 (21070-1-AP) by Proteintech is a Polyclonal antibody targeting ELOF1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21070-1-AP targets ELOF1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HEK-293 cells,  rat testis tissue\nPositive IF\/ICC detected in: A549 cells, SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELOF1 (elongation factor 1 homologue) is a small (83 aa), evolutionarily conserved, RNAPII-associated transcription elongation factor that is also a core component of the transcription-coupled DNA repair machinery with an additional role in preventing DNA damage during DNA replication (PMID: 34108663). Loss of ELOF1 strongly compromises AID-mediated deamination, SHM, and CSR, and that this is accompanied by a decrease in parameters of RNAPII pausing\/stalling and in RNAPII RNA synthesis without a decrease in levels of S2P-RNAPII (PMID: 39386505).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15213 Product name: Recombinant human ELOF1 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-83 aa of BC007516 Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ Predict reactive species\nFull Name: elongation factor 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 9.5 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC007516\nGene Symbol: ELOF1\nGene ID (NCBI): 84337\nRRID: AB_10693632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60002\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887513063593,"sku":"21070-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21070-1-ap","provider":"Iright","version":"1.0","type":"link"}