{"product_id":"proteintech-21106-1-ap","title":"Proteintech, 21106-1-AP, Collagen Type XXVI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type XXVI (21106-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XXVI in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21106-1-AP targets Collagen Type XXVI in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL26A1(Collagen alpha-1(XXVI) chain), also known as EMID2. It is expected to be located in the cytoplasm and extracellular space. COL26A1 is expressed in many tissues, especially in brain tissues, including cerebral cortex, cerebellum and basal ganglia. In the single cell type, the expression of COL26A1 is mainly concentrated in excitatory and inhibitory neurons. The protein is a new member of the collagen family. Its function has not been fully demonstrated in thyroid cancer (THCA), but it is known that collagen can promote cancer progression. COL26A1 may be involved in immune-related pathways, such as CTLA4 pathway, IL-10 signaling pathway and chemokine receptor binding chemokine. The molecular weight of COL26A1 is 45 kDa. COL26A1 is significantly up-regulated in thyroid carcinoma, and its high expression is related to poor prognosis. It is also significantly related to tumor microenvironment, which may involve immune-related pathways in the process of tumor occurrence(PMID: 38197076).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15382 Product name: Recombinant human EMID2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-247 aa of BC110393 Sequence: GFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEM Predict reactive species\nFull Name: EMI domain containing 2\nCalculated Molecular Weight: 441 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC110393\nGene Symbol: EMID2\nGene ID (NCBI): 136227\nRRID: AB_3669359\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96A83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886771687593,"sku":"21106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21106-1-ap","provider":"Iright","version":"1.0","type":"link"}