{"product_id":"proteintech-21129-1-ap","title":"Proteintech, 21129-1-AP, KIAA1199 \/ CEMIP  Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIAA1199 \/ CEMIP  (21129-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1199 \/ CEMIP  in WB, IHC, ELISA applications with reactivity to human, mouse samples\n21129-1-AP targets KIAA1199 \/ CEMIP  in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, COLO 320 cells,  U-87 MG cells,  HCT 116 cells,  SGC-7901 cells,  U2OS cells\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIAA1199, also known as CEMIP, was first discovered as an inner-ear protein whose genetic mutations were linked to nonsyndromic hearing loss. KIAA1199 is involved in hyaluronan degradation. Studies have shown that KIAA1199 is overexpressed in many types of cancers, suggesting a critical role of KIAA1199 in cancer progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, marmoset\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15527 Product name: Recombinant human KIAA1199 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-386 aa of BC020256 Sequence: TVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFA Predict reactive species\nFull Name: KIAA1199 \/ CEMIP\nCalculated Molecular Weight: 1361 aa, 153 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC020256\nGene Symbol: KIAA1199\nGene ID (NCBI): 57214\nRRID: AB_10695771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843233449,"sku":"21129-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21129-1-ap","provider":"Iright","version":"1.0","type":"link"}