{"product_id":"proteintech-21159-1-ap","title":"Proteintech, 21159-1-AP, TEAD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TEAD2 (21159-1-AP) by Proteintech is a Polyclonal antibody targeting TEAD2 in WB, ELISA applications with reactivity to human,  mouse samples\n21159-1-AP targets TEAD2 in WB, IHC, ChIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEAD2 belongs to a protein family that share the TEA\/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also it can modulate SV40 late transcription together with large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins , a TBP-associated factors and a limiting transcriptional intermediary factors. TEAD2 also preforms an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1\/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. TEAD2 is strongly expressed in human ovarian carcinoma cell line.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14074 Product name: Recombinant human TEAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-251 aa of BC051301 Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR Predict reactive species\nFull Name: TEA domain family member 2\nCalculated Molecular Weight: 447 aa, 49 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC051301\nGene Symbol: TEAD2\nGene ID (NCBI): 8463\nRRID: AB_2861186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908867753,"sku":"21159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21159-1-ap","provider":"Iright","version":"1.0","type":"link"}