{"product_id":"proteintech-21180-1-ap","title":"Proteintech, 21180-1-AP, S1PR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S1PR2 (21180-1-AP) by Proteintech is a Polyclonal antibody targeting S1PR2 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human samples\n21180-1-AP targets S1PR2 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  MCF-7 cells,  MDA-MB-231 cells\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS1PR2 (sphingosine-1-phosphate receptor 2), also known as S1P2 or EDG5, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P), a biologically active metabolic product of sphingolipid (PMID: 18787560). S1P and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR2 plays a role in acute vascular inflammation (PMID: 23723450). S1PR2 signaling is implicated in STAT3 activation (PMID: 22606352).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15470 Product name: Recombinant human S1PR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-353 aa of BC069598 Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV Predict reactive species\nFull Name: sphingosine-1-phosphate receptor 2\nCalculated Molecular Weight: 353 aa, 39 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC069598\nGene Symbol: S1PR2\nGene ID (NCBI): 9294\nRRID: AB_10694573\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95136\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839104681,"sku":"21180-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21180-1-ap","provider":"Iright","version":"1.0","type":"link"}