{"product_id":"proteintech-21196-1-ap","title":"Proteintech, 21196-1-AP, EYA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EYA3 (21196-1-AP) by Proteintech is a Polyclonal antibody targeting EYA3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n21196-1-AP targets EYA3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  L02 cells\nPositive IP detected in: L02 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEYA3(Eyes absent homolog 3) belongs to the HAD-like hydrolase superfamily.Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis.EYA3, like EYA1, is expressed in the ninth week of human development and may also underlie developmental defects(PMID:9020840).It has 2 isoforms produced by alternative splicing.This antibody is specific to EYA3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15544 Product name: Recombinant human EYA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC029500 Sequence: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS Predict reactive species\nFull Name: eyes absent homolog 3 (Drosophila)\nCalculated Molecular Weight: 573 aa, 63 kDa\nObserved Molecular Weight: 63-66 kDa\nGenBank Accession Number: BC029500\nGene Symbol: EYA3\nGene ID (NCBI): 2140\nRRID: AB_10732957\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99504\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940914857,"sku":"21196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21196-1-ap","provider":"Iright","version":"1.0","type":"link"}