{"product_id":"proteintech-21206-1-ap","title":"Proteintech, 21206-1-AP, HSPA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPA4 (21206-1-AP) by Proteintech is a Polyclonal antibody targeting HSPA4 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, monkey samples\n21206-1-AP targets HSPA4 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, HEK-293 cells,  mouse testis tissue,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissue,  human breast cancer tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HepG2 cells\nPositive FC (Intra) detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (HSP110) subfamily of HSP70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors. This antibody well recognized the endogenous HSPA4 protein in mouse brain\/ testis tissues. (PMID: 21487003)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15581 Product name: Recombinant human HSPA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-840 aa of BC110861 Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID Predict reactive species\nFull Name: heat shock 70kDa protein 4\nCalculated Molecular Weight: 840 aa, 94 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC110861\nGene Symbol: HSPA4\nGene ID (NCBI): 3308\nRRID: AB_10733641\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P34932\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868982726825,"sku":"21206-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21206-1-ap","provider":"Iright","version":"1.0","type":"link"}