{"product_id":"proteintech-21211-1-ap","title":"Proteintech, 21211-1-AP, Mammaglobin B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mammaglobin B (21211-1-AP) by Proteintech is a Polyclonal antibody targeting Mammaglobin B in IHC, ELISA applications with reactivity to human samples\n21211-1-AP targets Mammaglobin B in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammaglobin B, also referred to as secretoglobin family 2A member 1 (SCGB2A1), is a member of the uteroglobin superfamily. SCGB2A1 has been identified as a candidate biomarker for the detection of lymph node micrometastases in breast cancer and abdominal cancer types. SCGB2A1 has been considered as a promising diagnostic marker for occult tumor cells in effusions of several malignancies and as a potential immunotherapeutic target in ovarian cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15609 Product name: Recombinant human Mammaglobin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-95 aa of BC062218 Sequence: IDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN Predict reactive species\nFull Name: secretoglobin, family 2A, member 1\nCalculated Molecular Weight: 95 aa, 11 kDa\nGenBank Accession Number: BC062218\nGene Symbol: Mammaglobin B\nGene ID (NCBI): 4246\nRRID: AB_3085644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887712030889,"sku":"21211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21211-1-ap","provider":"Iright","version":"1.0","type":"link"}