{"product_id":"proteintech-21223-1-ap","title":"Proteintech, 21223-1-AP, SCO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCO2 (21223-1-AP) by Proteintech is a Polyclonal antibody targeting SCO2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n21223-1-AP targets SCO2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HUVEC cells,  HepG2 cells\nPositive IHC detected in: mouse skeletal muscle tissue, human hepatocirrhosis tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman SCO2 is a mitochondrial membrane-bound protein involved in copper supply for the assembly of cytochrome c oxidase in eukaryotes.It is involved in the maintenance of cell copper homeostasis or, limited to HSco2, as a downstream mediator of the Warburg effect, as its expression is regulated by p53(PMID:17850752).This protein belongs to the SCO1\/2 family and defects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15663 Product name: Recombinant human SCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC102025 Sequence: MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS Predict reactive species\nFull Name: SCO cytochrome oxidase deficient homolog 2 (yeast)\nCalculated Molecular Weight: 266 aa, 30 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC102025\nGene Symbol: SCO2\nGene ID (NCBI): 9997\nRRID: AB_10694574\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43819\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914471081,"sku":"21223-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21223-1-ap","provider":"Iright","version":"1.0","type":"link"}