{"product_id":"proteintech-21224-1-ap","title":"Proteintech, 21224-1-AP, MORN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MORN2 (21224-1-AP) by Proteintech is a Polyclonal antibody targeting MORN2 in IHC, ELISA applications with reactivity to human, mouse samples\n21224-1-AP targets MORN2 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\n(MORN2 is a testis-enriched protein and its initial expression coincides with the first wave of meiosis. MORN2 functions in the dynamic regulation of acrosome biogenesis during late spermiogenesis, and MORN2 has been shown to function in LC3-associated phagocytosis and in resistance to bacterial infection in planarians.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15665 Product name: Recombinant human MORN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC102035 Sequence: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM Predict reactive species\nFull Name: MORN repeat containing 2\nCalculated Molecular Weight: 79 aa, 9 kDa\nGenBank Accession Number: BC102035\nGene Symbol: MORN2\nGene ID (NCBI): 729967\nRRID: AB_3669362\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q502X0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722156201,"sku":"21224-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21224-1-ap","provider":"Iright","version":"1.0","type":"link"}