{"product_id":"proteintech-21245-1-ap","title":"Proteintech, 21245-1-AP, SYT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYT2 (21245-1-AP) by Proteintech is a Polyclonal antibody targeting SYT2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n21245-1-AP targets SYT2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  Neuro-2a cells\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYT2 (Synaptotagmin-2) a synaptic vesicle membrane protein, functions as a calcium sensor in vesicular trafficking and exocytosis. SYT2 is also plays a role in dendrite formation by melanocytes (PMID: 23999003). Mutations in SYT2 are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. SYT2 mutations cause a complex presynaptic congenital myasthenic syndrome (PMID: 26519543).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15744 Product name: Recombinant human SYT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC100815 Sequence: MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPL Predict reactive species\nFull Name: synaptotagmin II\nCalculated Molecular Weight: 419 aa, 47 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC100815\nGene Symbol: SYT2\nGene ID (NCBI): 127833\nRRID: AB_3085646\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N9I0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887821574313,"sku":"21245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21245-1-ap","provider":"Iright","version":"1.0","type":"link"}