{"product_id":"proteintech-21274-1-ap","title":"Proteintech, 21274-1-AP, TMEM64 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM64 (21274-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM64 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21274-1-AP targets TMEM64 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human prostate cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTmem64 (transmembrane protein 64) is a positive modulator of osteoclast differentiation by SERCA2-dependent Ca2+ signaling (PMID: 23395171). Altered Levels of mRNAs for Calcium-Binding\/Associated Proteins, Annexin A1, S100A4, and TMEM64 are associated with osteoporosis in peripheral blood mononuclear cells (PMID: 31814858). Tmem64 is involved in the metastatic progression of prostate cancer cells by regulating Wnt3a secretion (PMID: 31289498).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15753 Product name: Recombinant human TMEM64 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC113828 Sequence: DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTSGSSFYNKRTLTFSGGGINVV Predict reactive species\nFull Name: transmembrane protein 64\nCalculated Molecular Weight: 380 aa, 40 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC113828\nGene Symbol: TMEM64\nGene ID (NCBI): 169200\nRRID: AB_3085648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6YI46\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887833272489,"sku":"21274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-21274-1-ap","provider":"Iright","version":"1.0","type":"link"}